PDB entry 6ut9

View 6ut9 on RCSB PDB site
Description: Crystal structure of the carbohydrate-binding domain VP8* of human P[4] rotavirus strain BM5265
Class: virus
Keywords: Rotavirus, host receptor interaction, VIRUS
Deposited on 2019-10-29, released 2020-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene: VP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9BVI9 (2-End)
      • expression tag (0-1)
      • conflict (71)
      • conflict (85)
    Domains in SCOPe 2.08: d6ut9a1, d6ut9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ut9A (A:)
gsvldgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
fgenkqfnvennsdkwkffemfkgsgqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
rattdssntadlnnisiiihsefyiiprsqeskcneyinngl

    Sequence, based on observed residues (ATOM records): (download) 
    >6ut9A (A:)
gsvldgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
fgenkqfnvennsdkwkffemfkgsgqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
rattdssntadlnnisiiihsefyiiprsqeskcneyinng