PDB entry 6urs

View 6urs on RCSB PDB site
Description: sleeping beauty transposase pai subdomain mutant - h19y
Deposited on 2019-10-24, released 2020-10-28
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sleeping Beauty transposase PAI subdomain
    Species: Oncorhynchus mykiss [TaxId:8022]
    Gene: GSONMT00045019001
    Database cross-references and differences (RAF-indexed):
    • PDB 6URS (0-56)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ursA (A:)
asmgkskeisqdlrkrivdlyksgsslgaiskrlavprssvqtivrkykhhgttqhh