PDB entry 6uqv

View 6uqv on RCSB PDB site
Description: crystal structure of choe, a bacterial acetylcholinesterase from pseudomonas aeruginosa
Deposited on 2019-10-21, released 2020-05-13
The last revision was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ChoE
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: choE, PA4921
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, GOL, BUA, CL, P6G, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6uqvA (A:)
    htspllapvrqihafgdsysdngesqrltremlakgiagaqalpgevywqgrwsngptav
    evlarqlgaqladhavggaksgadnyygwmsayrhtglagqvdaylatldgkpvdgqalh
    fifvsandffehedfageqpleqlagssvaniraavqrlgeagarrflvvsstdlsvvpa
    vvagnrveraqrylqavnaslpiqlaalrktrglelswfdhltfsrhlrrnparyglvel
    dapcqptqpsvrpacanpdqyyfwdewhptrrvhqlageamaaryar