PDB entry 6unv

View 6unv on RCSB PDB site
Description: Crystal structure of a methanol tolerant lipase/esterase from the fungus Rasamsonia emersonii
Class: hydrolase
Keywords: Lipase, esterase, macaw oil hydrolysis, methanol tolerant, HYDROLASE
Deposited on 2019-10-13, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: RASAMSONIA EMERSONII [TaxId:68825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6unva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6unvA (A:)
    mgsshhhhhhssglvprgshmasapvelgrrdvsqdlfdqlnlfeqysaaaycsanneas
    agtaiscsagncplvqqagatilysfnnigsgdvtgflaldstnqlivlsfrgsetlenw
    iadleadlvdasaicsgceahdgflsswnsvastltskissavnehpsyklvftghslga
    alatlgavslresgynidlynygcprvgntaladfittqsggtnyrvthsddpvpklppr
    sfgysqpspeywitsgnnvtvqpsdieviegvdstagndgtpagldidahrwyfgpisac
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6unvA (A:)
    rdvsqdlfdqlnlfeqysaaaycsanneasagtaiscsagncplvqqagatilysfnnig
    gdvtgflaldstnqlivlsfrgsetlenwiadladlvdasaicceahgflsswnsvastl
    tskissavnehpsyklvftghslgaalatlgavslresgynidlynygcprvgntaladf
    ittqsggtnyrvthsddpvpklpprsfgysqpspeywitsgnnvtvqpsdieviegvdst
    agndgtpagldidahrwyfgpisacs