PDB entry 6un8

View 6un8 on RCSB PDB site
Description: Wild type ANT bound to neomycin
Class: transferase/antibiotic
Keywords: antibiotic resistance, neomycin, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2019-10-11, released 2020-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside nucleotidyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6un8a1, d6un8a2
  • Chain 'B':
    Compound: Aminoglycoside nucleotidyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6un8b1, d6un8b2
  • Heterogens: NMY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6un8A (A:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6un8A (A:)
    ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
    aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
    taksveaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhh
    ricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterh
    gyivdvskripf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6un8B (B:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf