PDB entry 6um9

View 6um9 on RCSB PDB site
Description: Gypsy Moth Pheromone-binding protein 1 (LdisPBP1) NMR Structure at pH 4.5
Class: lipid binding protein
Keywords: lipid binding protein
Deposited on 2019-10-09, released 2020-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone binding protein 1
    Species: Lymantria dispar [TaxId:13123]
    Gene: PBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6um9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6um9A (A:)
    skevmkqmtinfakpmeackqelnvpdavmqdffnfwkegyqitnreagcvilclakkle
    lldqdmnlhhgkamefamkhgadeamakqlldikhscekvitivaddpcqtmlnlamcfk
    aeihkldwaptldvavgelladt