PDB entry 6uid

View 6uid on RCSB PDB site
Description: structure of the cytoplasmic domain of the t3ss sorting platform protein pscd from p. aeruginosa
Deposited on 2019-09-30, released 2020-10-07
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EscD/YscD/HrpQ family type III secretion system inner membrane ring protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FAZ09_09230
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6uidA (A:)
gsmawkirfysglnqgaevslgegrvalgsdplqadlvlldegiaavhlvlevdaqgvrl
lewaegceprqdgqaqvagailqalagqtcgplrwtfcdpqrsfperfpeaevqtapvrr
kssaragg

    Sequence, based on observed residues (ATOM records):
    >6uidA (A:)
mawkirfysglnqgaevslgegrvalgsdplqadlvlldegiaavhlvlevdaqgvrlle
waegceprqdgqaqvagailqalagqtcgplrwtfcdpqrsfperfpeaevqtapvrrks