PDB entry 6ugq

View 6ugq on RCSB PDB site
Description: Human Carbonic Anhydrase IX-mimic complexed with SB4-206
Class: lyase/lyase inhibitor
Keywords: cyclical sulfonamide, inhibitor, LYASE, LYASE-LYASE INHIBITOR complex
Deposited on 2019-09-26, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic Anhydrase IX-mimic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • engineered mutation (61)
      • engineered mutation (63)
      • engineered mutation (65)
      • engineered mutation (87)
      • engineered mutation (126)
      • engineered mutation (165)
      • engineered mutation (199)
    Domains in SCOPe 2.08: d6ugqa_
  • Heterogens: Q7A, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ugqA (A:)
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk