PDB entry 6ufe

View 6ufe on RCSB PDB site
Description: the structure of a potassium selective ion channel at atomic resolution
Deposited on 2019-09-24, released 2020-08-05
The last revision was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transporter
  Species: Bacillus cereus [TaxId:1396]
  Gene: A9485_19160, BACERE00184_02078, CJ306_03585, CN950_06075, CN980_22870, COI98_17615, CON37_12595
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A164U772 (0-87)
    • engineered mutation (43)
    • engineered mutation (45)
    • expression tag (88-89)
• Chain 'B':
  Compound: Transporter
  Species: Bacillus cereus [TaxId:1396]
  Gene: A9485_19160, BACERE00184_02078, CJ306_03585, CN950_06075, CN980_22870, COI98_17615, CON37_12595
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A164U772 (0-87)
    • engineered mutation (43)
    • engineered mutation (45)
    • expression tag (88-91)
• Heterogens: MPD, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >6ufeA (A:)
  efqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgkiftil
  yifigiglvfgfihklavnvqlpsilsnlvpr
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6ufeA (A:)
  efqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgkiftil
  yifigiglvfgfihklavnvqlpsilsnlv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ufeB (B:)
  efqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgkiftil
  yifigiglvfgfihklavnvqlpsilsnlvpr