PDB entry 6ud7

View 6ud7 on RCSB PDB site
Description: Crystal structure of full-length human DCAF15-DDB1(deltaBPB)-DDA1-RBM39 in complex with indisulam
Class: ligase
Keywords: E3 ligase, neosubstrate, LIGASE
Deposited on 2019-09-18, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DDB1- and CUL4-associated factor 15
  Species: Homo sapiens [TaxId:9606]
  Gene: DCAF15, C19orf72
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q66K64 (Start-600)
• Chain 'B':
  Compound: DNA damage-binding protein 1,DNA damage-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: DDB1, XAP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16531 (Start-394)
  • Uniprot Q16531 (Start-835)
• Chain 'C':
  Compound: RNA-binding motif protein 39
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp781I1140
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z3L0 (0-80)
  Domains in SCOPe 2.08: d6ud7c_
• Chain 'D':
  Compound: DET1- and DDB1-associated protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: DDA1, C19orf58, PCIA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BW61
• Heterogens: EF6, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ud7C (C:)
  gpmrlyvgslhfnitedmlrgifepfgriesiqlmmdsetgrskgygfitfsdsecakka
  leqlngfelagrpmkvghvte
  

  
  
• Chain 'D':
  No sequence available.