PDB entry 6ucr

View 6ucr on RCSB PDB site
Description: structure of clpc1-ntd l92s l96p
Deposited on 2019-09-17, released 2020-05-13
The last revision was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Negative regulator of genetic competence clpC/mecB
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: clpC, ERS007720_03236
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U0SI28 (Start-144)
      • engineered mutation (91)
      • engineered mutation (95)
      • expression tag (145-154)
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ucrA (A:)
mferftdrarrvvvlaqeearmlnhnyigtehillglihegegvaaksleslgislegvr
sqveeiigqgqqapsghipftprakkvlelssreapqlghnyigtehillgliregegva
aqvlvklgaeltrvrqqviqllsgyklaaalehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6ucrA (A:)
ferftdrarrvvvlaqeearmlnhnyigtehillglihegegvaaksleslgislegvrs
qveeiigqgqqapsghipftprakkvlelssreapqlghnyigtehillgliregegvaa
qvlvklgaeltrvrqqviqllsgyklaaalehhh