PDB entry 6uck

View 6uck on RCSB PDB site
Description: proiapp in dpc micelles - two-conformer ensemble refinement, bent conformer
Deposited on 2019-09-16, released 2020-02-26
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Islet amyloid polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: IAPP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6uckA (A:)
tpieshqvekrkcntatcatqrlanflvhssnnfgailsstnvgsntygkrnavevlkre
plnylplkkkkd

    Sequence, based on observed residues (ATOM records):
    >6uckA (A:)
tpieshqvekrkcntatcatqrlanflvhssnnfgailsstnvgsntygkrnavevlkre
plnylpl