PDB entry 6uav

View 6uav on RCSB PDB site
Description: crystal structure of a gh128 (subgroup ii) endo-beta-1,3-glucanase from pseudomonas viridiflava (pvgh128_ii)
Deposited on 2019-09-11, released 2020-05-20
The last revision was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyco_hydro_cc domain-containing protein
    Species: Pseudomonas viridiflava [TaxId:33069]
    Gene: CFBP1590__2373
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6uavA (A:)
tksvkrgvaydvaspadlsalstgmswwynwspkphdrlaaydyagqynvdfvpmvwnan
lddgqlklyllahpgiryllvinepnlvdqanmtpqaaaqlwprleqisaqtgvklvgpa
mnwgtmtgygdpvawldafyaayasahqgrdpqidylafhwydyglssmldrlsrygkpf
wvtefanwhtlddglqidslekqkqqmaemvtmlerrsdvfryawftgrmtpdphfssll
daegrltelgqyylslpys