PDB entry 6u9z

View 6u9z on RCSB PDB site
Description: wild-type mthk pore in 6 mm k+
Deposited on 2019-09-09, released 2020-11-04
The last revision was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-gated potassium channel mthK
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mthK, MTH_1520
    Database cross-references and differences (RAF-indexed):
  • Heterogens: K, HEZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6u9zA (A:)
vpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftv
tlivlgigtfavaverllefli