PDB entry 6u7v

View 6u7v on RCSB PDB site
Description: xrrm structure of sppof8
Deposited on 2019-09-03, released 2020-09-09
The last revision was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein pof8
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: pof8, SPAC17G6.17
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6u7vA (A:)
    svsktsqtdkdednldftknlltriknlhpltnkstihsllsyvfsrqtqniacepmyid
    yrkdeteaiirwktplhaetcinafrtqerkqnshddirahrkkgssrpfliaelitgee
    eknywrmlkk
    

    Sequence, based on observed residues (ATOM records):
    >6u7vA (A:)
    ldftknlltriknlhpltnkstihsllsyvfsrqtqniacepmyidyrkdeteaiirwkt
    plhaetcinafrtqerkqnshddirahrkkgssrpfliaelitgeeeknywrmlkk