PDB entry 6u7o

View 6u7o on RCSB PDB site
Description: HIV-1 wild type protease with GRL-00819A, with phenyl-boronic-acid as P2'-ligand and with a 6-5-5-ring fused crown-like tetrahydropyranofuran as the P2-ligand
Class: viral protein
Keywords: aspartic acid protease, hiv-1 protease inhibitor of grl-00819a, boronic acid, viral protein
Deposited on 2019-09-03, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d6u7oa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d6u7ob_
• Heterogens: Q1D, NA, CL, FMT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6u7oA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6u7oB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf