PDB entry 6u6v

View 6u6v on RCSB PDB site
Description: crystal structure of human pd-1h / vista
Deposited on 2019-08-30, released 2020-01-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type immunoglobulin domain-containing suppressor of T-cell activation
    Species: Homo sapiens [TaxId:9606]
    Gene: VSIR, C10orf54, SISP1, VISTA, PP2135, UNQ730/PRO1412
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6u6vA (A:)
fkvatpyslyvcpegqnvtltcrllgpvdkghdvtfyktwyrssrgevqtcserrpirnl
tfqdlhlhhgghqaantshdlaqrhglesasdhhgnfsitmrnltlldsglycclvveir
hhhsehrvhgamelqvqtgkdapsncvvypsssqesenitavklqagfhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6u6vA (A:)
fkvatpyslyvcpegqnvtltcrllgdvtfyktwyrssrgevqtcserrpirnltfqdlh
lhhgghqaantshdlaqrhglesasdhhgnfsitmrnltlldsglycclvveirhhhseh
rvhgamelqvqtgkdapsncvvypsss