PDB entry 6u6r

View 6u6r on RCSB PDB site
Description: solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae
Deposited on 2019-08-30, released 2020-07-08
The last revision was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division topological specificity factor
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: minE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell division topological specificity factor
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: minE
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6u6rA (A:)
aqegqtpdylptlrkelmevlskyvnvsldnirisqekqdgmdvlelnitlpeqkkvleh
hhhhh

    Sequence, based on observed residues (ATOM records):
    >6u6rA (A:)
dylptlrkelmevlskyvnvsldnirisqekqdgmdvlelnitl

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6u6rB (B:)
aqegqtpdylptlrkelmevlskyvnvsldnirisqekqdgmdvlelnitlpeqkkvleh
hhhhh

    Sequence, based on observed residues (ATOM records):
    >6u6rB (B:)
dylptlrkelmevlskyvnvsldnirisqekqdgmdvlelnitl