PDB entry 6u6n

View 6u6n on RCSB PDB site
Description: Structure of the trimeric globular domain of Adiponectin mutant - D187A Q188A
Class: hormone
Keywords: hormone, globular domain
Deposited on 2019-08-30, released 2020-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Adiponectin
    Species: Homo sapiens [TaxId:9606]
    Gene: ADIPOQ, ACDC, ACRP30, APM1, GBP28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15848 (Start-142)
      • engineered mutation (85-86)
    Domains in SCOPe 2.08: d6u6nc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u6nC (C:)
    gpggssayvyrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfa
    yhitvymkdvkvslfkkdkamlftyaayqennvdqasgsvllhlevgdqvwlqvygeger
    nglyadndndstftgfllyhdtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u6nC (C:)
    yrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkd
    vkvslfkkdkamlftyaayqennvdqasgsvllhlevgdqvwlqvygegendstftgfll
    yhdtn