PDB entry 6u62

View 6u62 on RCSB PDB site
Description: Raptor-Rag-Ragulator complex
Class: signaling protein
Keywords: signaling complex, GTPase, lysosome, SIGNALING PROTEIN
Deposited on 2019-08-29, released 2019-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: EM
Resolution: 3.18 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory-associated protein of mtor
    Species: Homo sapiens [TaxId:9606]
    Gene: RPTOR, KIAA1303, RAPTOR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related GTP-binding protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAGA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras-related GTP-binding protein C
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAGC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB90
      • engineered mutation (75)
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6u62e_
  • Chain 'F':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6u62f_
  • Chain 'G':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GDP, GTP, MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6u62E (E:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u62E (E:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6u62F (F:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
    vevsenlyfqgssgwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u62F (F:)
    ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk
    lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvve
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.