PDB entry 6u5s

View 6u5s on RCSB PDB site
Description: NTD of GluA2 in complex with CNIH3 - with antagonist ZK200775 - in pseudo-symmetric global conformation
Class: transport protein
Keywords: ionotropic glutamate receptor, AMPA receptor, cornichon, auxiliary subunit, ion channel, ligand gated ion channel, synaptic transmission, excitatory synaptic transmission, neurotransmitter receptor, stargazin, TARP, ZK200775, lipid, MPQX, TRANSPORT PROTEIN
Deposited on 2019-08-28, released 2019-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: EM
Resolution: 3.07 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u5sa_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u5sb_
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u5sc_
  • Chain 'D':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u5sd_
  • Heterogens: BMA, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u5sA (A:)
    mqkimhisvllspvlwglifgvssnsiqigglfprgadqeysafrvgmvqfstsefrltp
    hidnlevansfavtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdg
    thpfviqmrpdlkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainv
    gninndkkdetyrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianl
    gftdgdllkiqfgganvsgfqivdyddslvskfierwstleekeypgahtatikytsalt
    ydavqvmteafrnlrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgni
    kfdqngkrinytinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvtt
    ilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtki
    wngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfld
    playeiwmcivfayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwf
    slgafmrqgcdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneqgll
    dklknkwwydkgecgsgggdskektsalslsnvagvfyilvgglglamlvaliefcyksr
    aeakrmkvaknpqninpsssqnsqnfatdykddddkegynvygiesvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u5sA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u5sB (B:)
    mqkimhisvllspvlwglifgvssnsiqigglfprgadqeysafrvgmvqfstsefrltp
    hidnlevansfavtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdg
    thpfviqmrpdlkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainv
    gninndkkdetyrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianl
    gftdgdllkiqfgganvsgfqivdyddslvskfierwstleekeypgahtatikytsalt
    ydavqvmteafrnlrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgni
    kfdqngkrinytinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvtt
    ilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtki
    wngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfld
    playeiwmcivfayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwf
    slgafmrqgcdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneqgll
    dklknkwwydkgecgsgggdskektsalslsnvagvfyilvgglglamlvaliefcyksr
    aeakrmkvaknpqninpsssqnsqnfatdykddddkegynvygiesvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u5sB (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u5sC (C:)
    mqkimhisvllspvlwglifgvssnsiqigglfprgadqeysafrvgmvqfstsefrltp
    hidnlevansfavtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdg
    thpfviqmrpdlkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainv
    gninndkkdetyrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianl
    gftdgdllkiqfgganvsgfqivdyddslvskfierwstleekeypgahtatikytsalt
    ydavqvmteafrnlrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgni
    kfdqngkrinytinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvtt
    ilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtki
    wngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfld
    playeiwmcivfayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwf
    slgafmrqgcdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneqgll
    dklknkwwydkgecgsgggdskektsalslsnvagvfyilvgglglamlvaliefcyksr
    aeakrmkvaknpqninpsssqnsqnfatdykddddkegynvygiesvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u5sC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6u5sD (D:)
    mqkimhisvllspvlwglifgvssnsiqigglfprgadqeysafrvgmvqfstsefrltp
    hidnlevansfavtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdg
    thpfviqmrpdlkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainv
    gninndkkdetyrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianl
    gftdgdllkiqfgganvsgfqivdyddslvskfierwstleekeypgahtatikytsalt
    ydavqvmteafrnlrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgni
    kfdqngkrinytinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvtt
    ilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtki
    wngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfld
    playeiwmcivfayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwf
    slgafmrqgcdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneqgll
    dklknkwwydkgecgsgggdskektsalslsnvagvfyilvgglglamlvaliefcyksr
    aeakrmkvaknpqninpsssqnsqnfatdykddddkegynvygiesvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u5sD (D:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt