PDB entry 6u3s

View 6u3s on RCSB PDB site
Description: solution nmr structure of the dnajb6b deltast variant (aligned on the ctd domain)
Deposited on 2019-08-22, released 2019-10-09
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaJ homolog subfamily B member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: DNAJB6, HSJ2, MRJ, MSJ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75190 (1-127)
      • expression tag (0)
      • linker (128-131)
    • Uniprot O75190 (132-189)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6u3sA (A:)
gmvdyyevlgvqrhaspedikkayrklalkwhpdknpenkeeaerkfkqvaeayevlsda
kkrdiydkygkeglnggggggshfdspfefgftfrnpddvfreffggrdpfsfdffedpf
edffgnrrgprggmgnfksiststkmvngrkittkrivengqerveveedgqlkslting
keqllrldnk