PDB entry 6u2h

View 6u2h on RCSB PDB site
Description: BRAF dimer bound to 14-3-3
Class: SIGNALING PROTEIN/Transferase
Keywords: BRAF, 14-3-3, kinase, complex, SIGNALING PROTEIN, SIGNALING PROTEIN-Transferase complex
Deposited on 2019-08-19, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u2ha_
  • Chain 'B':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63104 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6u2hb1, d6u2hb2
  • Chain 'C':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056
      • conflict (97-98)
      • conflict (105)
      • conflict (116)
      • conflict (142)
      • conflict (184)
      • conflict (221)
      • conflict (227)
      • conflict (242)
      • conflict (260)
      • conflict (263)
      • conflict (267)
      • conflict (270)
      • conflict (274)
    Domains in SCOPe 2.07: d6u2hc_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056
      • conflict (97-98)
      • conflict (105)
      • conflict (116)
      • conflict (142)
      • conflict (184)
      • conflict (221)
      • conflict (227)
      • conflict (242)
      • conflict (260)
      • conflict (263)
      • conflict (267)
      • conflict (270)
      • conflict (274)
    Domains in SCOPe 2.07: d6u2hd_
  • Heterogens: 29L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u2hA (A:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2hA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u2hB (B:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2hB (B:)
    smdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrssw
    rvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfyl
    kmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyy
    eilnspekacslaktafdeaiaesykdstlimqllrdnltlwt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u2hC (C:)
    gsddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvl
    rktrhvnillfmgystkpqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmd
    ylhaksiihrdlksnniflhedntvkigdfglatvksrwsgshqfeqlsgsilwmapevi
    rmqdsnpysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgrgslspdlskvrsnc
    pkrmkrlmaeclkkkrderpsfprilaeieelarelpkihrsasepslnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2hC (C:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmdyl
    haksiihrdlksnniflhedntvkigdfglatvksrgsilwmapevirmqdsnpysfqsd
    vyafgivlyelmtgqlpysninnrdqiiemvgrgslspdlskvrsncpkrmkrlmaeclk
    kkrderpsfprilaeieelarelpkihrsasepsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6u2hD (D:)
    gsddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvl
    rktrhvnillfmgystkpqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmd
    ylhaksiihrdlksnniflhedntvkigdfglatvksrwsgshqfeqlsgsilwmapevi
    rmqdsnpysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgrgslspdlskvrsnc
    pkrmkrlmaeclkkkrderpsfprilaeieelarelpkihrsasepslnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2hD (D:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmdyl
    haksiihrdlksnniflhedntvkigdfglatvksrwsgseqlsgsilwmapevirmqds
    npysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgrgslspdlskvrsncpkrmk
    rlmaeclkkkrderpsfprilaeieelarelpkihrsasepsl