PDB entry 6u1u

View 6u1u on RCSB PDB site
Description: Human Angiopoietin-Like 4 C-Terminal Domain (cANGPTL4) with Palmitic Acid
Class: signaling protein
Keywords: Fibrinogen-like domain, Angiogenesis, Cancer cells, Metastasis, SIGNALING PROTEIN
Deposited on 2019-08-16, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-related protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ANGPTL4, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6u1ua_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6u1uA (A:)
prdcqelfqvgerqsglfeiqpqgsppflvnckmtsdggwtviqrrhdgsvdfnrpweay
kagfgdphgefwlglekvhsitgdrnsrlavqlrdwdgnaellqfsvhlggedtayslql
tapvagqlgattvppsglsvpfstwdqdhdlrrdkncakslsggwwfgtcshsnlngqyf
rsipqqrqklkkgifwktwrgryyplqattmliqpm