PDB entry 6u1t

View 6u1t on RCSB PDB site
Description: Crystal structure of anti-Nipah virus (NiV) F 5B3 antibody Fab fragment
Class: immune system
Keywords: Nipah virus, Hendra virus, Henipavirus, Fusion glycoprotein, antibody neutralization, Fab, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, IMMUNE SYSTEM
Deposited on 2019-08-16, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antigen-binding (Fab) fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6U1T (0-220)
  • Chain 'L':
    Compound: antigen-binding (Fab) fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6U1T (0-213)
    Domains in SCOPe 2.07: d6u1tl1, d6u1tl2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6u1tL (L:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqfystpftfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec