PDB entry 6tyh

View 6tyh on RCSB PDB site
Description: four-disulfide insulin analog a22/b22
Deposited on 2019-08-08, released 2019-11-13
The last revision was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'B':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Chain 'C':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'D':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Chain 'E':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'F':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Chain 'G':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'H':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Chain 'I':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'J':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Chain 'K':
    Compound: insulin A chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (21)
  • Chain 'L':
    Compound: insulin B chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (21)
  • Heterogens: IPH, ACN, ZN, CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhA (A:)
giveqcctsicslyqlenycnc

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6tyhB (B:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhB (B:)
fvnqhlcgshlvealylvcgecgffytp

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhC (C:)
giveqcctsicslyqlenycnc

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6tyhD (D:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhD (D:)
fvnqhlcgshlvealylvcgecgffytpk

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhE (E:)
giveqcctsicslyqlenycnc

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6tyhF (F:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhF (F:)
fvnqhlcgshlvealylvcgecgffytpk

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhG (G:)
giveqcctsicslyqlenycnc

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6tyhH (H:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhH (H:)
fvnqhlcgshlvealylvcgecgffytpk

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhI (I:)
giveqcctsicslyqlenycnc

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6tyhJ (J:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhJ (J:)
fvnqhlcgshlvealylvcgecgffytpk

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >6tyhK (K:)
giveqcctsicslyqlenycnc

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6tyhL (L:)
fvnqhlcgshlvealylvcgecgffytpkt

    Sequence, based on observed residues (ATOM records):
    >6tyhL (L:)
fvnqhlcgshlvealylvcgecgffytpk