PDB entry 6tx7

View 6tx7 on RCSB PDB site
Description: crystal structure of human fkbp51 fk1 domain a19t mutant in complex with 2-piperidone
Class: isomerase
Keywords: PPIase, Fragment, ISOMERASE
Deposited on 2020-01-13, released 2020-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP5, AIG6, FKBP51
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13451 (3-127)
    • expression tag (0-2)
    • engineered mutation (6)
  Domains in SCOPe 2.08: d6tx7a1, d6tx7a2
• Heterogens: V1L, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6tx7A (A:)
  gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
  rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
  elldfkge