PDB entry 6tx6

View 6tx6 on RCSB PDB site
Description: crystal structure of human fkbp51 fk1 domain a19t mutant in complex with nicotinamide
Class: isomerase
Keywords: PPIase, Fragment, ISOMERASE
Deposited on 2020-01-13, released 2020-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5, AIG6, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d6tx6a1, d6tx6a2
  • Heterogens: NCA, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6tx6A (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge