PDB entry 6twe

View 6twe on RCSB PDB site
Description: Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A
Class: oxidoreductase
Keywords: lytic polysaccharide monooxygenase, lpmo, AA10, Chitin, oxidoreductase, copper
Deposited on 2020-01-13, released 2020-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative chitin binding protein
    Species: Bacillus licheniformis DSM 13 = ATCC 14580 [TaxId:279010]
    Gene: chbB, BL00145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6twea_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tweA (A:)
    hgfiekpgsraalcseafgflnlncgsvmyepqsleakkgfphsgpadgqiasagglfgg
    ildqqsenrwfkhimtggehtftwtytaphntsqwhyyitkkgwdpdkplkradfeliga
    vphdgspasrnlshhiyipedrlgyhvilavwdvadtenafyqvidvdlvnk