PDB entry 6tv0

View 6tv0 on RCSB PDB site
Description: Serratia spp. cyanase hydratase
Class: hydrolase
Keywords: Enzyme, Lyase, HYDROLASE
Deposited on 2020-01-08, released 2021-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0a1, d6tv0a2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0b1, d6tv0b2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0c1, d6tv0c2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0d1, d6tv0d2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0e1, d6tv0e2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0f1, d6tv0f2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0g1, d6tv0g2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0h1, d6tv0h2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0i1, d6tv0i2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Serratia sp. [TaxId:616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tv0j1, d6tv0j2
  • Heterogens: GOL, OXD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0A (A:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0B (B:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0C (C:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0D (D:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0E (E:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0F (F:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0G (G:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0H (H:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0I (I:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tv0J (J:)
    tqslhhsssrealtdiimdakirknltfeainegtglslafvtaallgqhplpeqaarvv
    aakldldedavrllqtiplrgsipsgvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf