PDB entry 6tup

View 6tup on RCSB PDB site
Description: cryo-em structure of pf4 bacteriophage coat protein with single- stranded dna
Deposited on 2020-01-08, released 2020-02-26
The last revision was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: EM
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coat protein B of bacteriophage Pf1
    Species: Pseudomonas virus Pf1 [TaxId:2011081]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: DNA (5'-d(p*ap*ap*ap*ap*ap*a)-3')
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tupA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
    

  • Chain 'z':
    No sequence available.