PDB entry 6tub

View 6tub on RCSB PDB site
Description: beta-endorphin amyloid fibril
Deposited on 2020-01-05, released 2020-10-28
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)
• Chain 'B':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)
• Chain 'C':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)
• Chain 'D':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)
• Chain 'E':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)
• Chain 'F':
  Compound: Beta-endorphin
  Species: Homo sapiens [TaxId:9606]
  Gene: POMC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01189 (0-30)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubA (A:)
  yggfmtseksqtplvtlfknaiiknaykkge
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubB (B:)
  yggfmtseksqtplvtlfknaiiknaykkge
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubC (C:)
  yggfmtseksqtplvtlfknaiiknaykkge
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubD (D:)
  yggfmtseksqtplvtlfknaiiknaykkge
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubE (E:)
  yggfmtseksqtplvtlfknaiiknaykkge
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records:
  

  >6tubF (F:)
  yggfmtseksqtplvtlfknaiiknaykkge