SCOPe 2.08: Structural Classification of Proteins

PDB entry 6tu6

View 6tu6 on RCSB PDB site
Description: kemp eliminase hg3.17 mutant q50m, e47n, n300d complexed with transition state analog 6-nitrobenzotriazole
Deposited on 2020-01-02, released 2020-04-01
The last revision was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'B':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'C':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'D':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'E':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'F':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'G':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'H':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'I':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'J':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'K':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'L':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'M':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'N':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'O':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Chain 'P':
Compound: Kemp Eliminase HG3.17 mutant Q50M, E47N, N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- PDB 6TU6
Heterogens: 6NT, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>6tu6A (A:)
maeaaqsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmmwdatepsq
gnfnfagadylvnwaqqngkligagclvwhnflpswvssitdkntlinvmknhittlmtr
ykgkirtwdvvgeafnedgslrqnvflnvigedyipiafqtaraadpnaklyimdynlds
asypktqaivnrvkqwraagvpidgigsqmhlsagqgagvlqalpllasagtpevsilml
dvagasptdyvnvvnaclnvqscvgitvmgvadpdsafasstpllfdgnfnpkpaynaiv
qdlqqgsiegrghhhhh