PDB entry 6tte

View 6tte on RCSB PDB site
Description: Beta-galactosidase in complex with PETG
Class: sugar binding protein
Keywords: Bgal, PETG, SUGAR BINDING PROTEIN
Deposited on 2019-12-27, released 2020-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: EM
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tteA (A:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tteA (A:)
    vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav
    peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv
    deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl
    rwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcge
    lrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnly
    ravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmde
    qtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltdd
    prwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegg
    gadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggf
    akywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfa
    drtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevp
    ldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvt
    lpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapl
    dndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktl
    fisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdr
    ltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlme
    tshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tteB (B:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tteB (B:)
    vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav
    peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv
    deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl
    rwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcge
    lrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnly
    ravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmde
    qtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltdd
    prwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegg
    gadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggf
    akywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfa
    drtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevp
    ldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvt
    lpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapl
    dndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktl
    fisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdr
    ltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlme
    tshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6tteC (C:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tteC (C:)
    vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav
    peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv
    deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl
    rwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcge
    lrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnly
    ravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmde
    qtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltdd
    prwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegg
    gadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggf
    akywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfa
    drtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevp
    ldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvt
    lpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapl
    dndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktl
    fisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdr
    ltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlme
    tshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6tteD (D:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tteD (D:)
    vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav
    peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv
    deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl
    rwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcge
    lrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnly
    ravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmde
    qtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltdd
    prwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegg
    gadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggf
    akywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfa
    drtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevp
    ldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvt
    lpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapl
    dndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktl
    fisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdr
    ltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlme
    tshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk