PDB entry 6trs

View 6trs on RCSB PDB site
Description: Crystal structure of TFIIH subunit p52 in complex with p8
Class: transcription
Keywords: TFIIH, DNA repair, transcription
Deposited on 2019-12-19, released 2020-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA polymerase II transcription factor B subunit 2
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0044720
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0S965 (26-End)
    • expression tag (14-25)
    • conflict (225)
    • conflict (225)
    • conflict (225)
• Chain 'B':
  Compound: RNA polymerase II transcription factor B subunit 2
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0044720
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0S965 (26-419)
    • expression tag (10-25)
    • conflict (225)
    • conflict (225)
    • conflict (225-226)
    • conflict (226)
    • conflict (226)
• Chain 'D':
  Compound: Uncharacterized protein
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0052580
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SDQ1
  Domains in SCOPe 2.08: d6trsd_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >6trsD (D:)
  mkhhhhhhpmsdydipttenlyfqgamvrairgvliecepaiksiivhldsinhdfiied
  lddhhlvvkenmvqilkqkledrlretyrpeepladsd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6trsD (D:)
  airgvliecepaiksiivhldsinhdfiiedlddhhlvvkenmvqilkqkledrlretyr
  peepla