PDB entry 6trm

View 6trm on RCSB PDB site
Description: Solution structure of the antifungal protein PAFC
Class: antimicrobial protein
Keywords: solution structure, disulphide protein, pafc, structure from cyana 2.1, antimicrobial protein
Deposited on 2019-12-19, released 2020-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pc21g12970 protein
    Species: Penicillium rubens Wisconsin 54-1255 [TaxId:500485]
    Gene: Pc21g12970, PCH_Pc21g12970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6trma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6trmA (A:)
dtcgggygvdqrrtnspcqasngdrhfcgcdrtgiveckggkwteiqdcggascrgvsqg
garc