PDB entry 6tqb

View 6tqb on RCSB PDB site
Description: x-ray structure of roquin roq domain in complex with a ucp3 cde1 sl rna motif
Deposited on 2019-12-16, released 2020-05-27
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Roquin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Rc3h1, Gm551, Kiaa2025
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA (5'-r(p*gp*gp*ap*ap*ap*up*up*ap*up*ap*up*up*ap*ap*up*up*up*cp*c)-3')
    Species: Mus musculus, synthetic [TaxId:10090]
  • Heterogens: EDO, NA, CL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6tqbA (A:)
eeegriramraarslgertvtelilqhqnpqqlssnlwaavrargcqflgpamqeealkl
vllaledgsalsrkvlvlfvvqrleprfpqasktsighvvqllyrascfkvtkrdedssl
mqlkeefrtyealrrehdsqivqiameaglriapdqwssllygdqshkshmqsiidklqt

    Sequence, based on observed residues (ATOM records):
    >6tqbA (A:)
hqnpqqlssnlwaavrargcqflgpamqeealklvllaledgsalsrkvlvlfvvqrlep
rfpqasktsighvvqllyrascfkvtkrdedsslmqlkeefrtyealrrehdsqivqiam
eaglriapdqwssllygdqshkshmqsiidklq

  • Chain 'B':
    No sequence available.