PDB entry 6tpu

View 6tpu on RCSB PDB site
Description: Crystal structures of FNIII domain three and four of the human leucocyte common antigen-related protein, LAR
Class: cell adhesion
Keywords: Fibronectin type-III, adhesion protein, CELL ADHESION
Deposited on 2019-12-14, released 2020-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRF, LAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10586 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6tpua1, d6tpua2, d6tpua3
  • Chain 'B':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRF, LAR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tpub1, d6tpub2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tpuA (A:)
    gaqpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytled
    lkpdtlyrfqlaarsdmgvgvftptieartaqstpsappqkvmcvsmgsttvrvswvppp
    adsrngvitqysvayeavdgedrgrhvvdgisrehsswdlvglekwteyrvwvrahtdvg
    pgpesspvlvrtded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tpuA (A:)
    gaqpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytled
    lkpdtlyrfqlaarsdmgvgvftptieartaqstpsappqkvmcvsmgsttvrvswvppp
    adsrngvitqysvayeavdgedrgrhvvdgisrehsswdlvglekwteyrvwvrahtdvg
    pgpesspvlvrtde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tpuB (B:)
    gaqpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytled
    lkpdtlyrfqlaarsdmgvgvftptieartaqstpsappqkvmcvsmgsttvrvswvppp
    adsrngvitqysvayeavdgedrgrhvvdgisrehsswdlvglekwteyrvwvrahtdvg
    pgpesspvlvrtded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tpuB (B:)
    qpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytledlk
    pdtlyrfqlaarsdmgvgvftptieartaqstpsappqkvmcvsmgsttvrvswvpppad
    srngvitqysvayeavdgedrgrhvvdgisrehsswdlvglekwteyrvwvrahtdvgpg
    pesspvlvrtded