PDB entry 6toj

View 6toj on RCSB PDB site
Description: Crystal structure of human BCL6 BTB domain in complex with compound 17a
Class: transcription
Keywords: Cancer, Lymphoma, Inhibitor, Degrader, TRANSCRIPTION
Deposited on 2019-12-11, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (19-143)
      • expression tag (13-18)
    Domains in SCOPe 2.08: d6toja1, d6toja2
  • Heterogens: NQQ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6tojA (A:)
gpgldykddddkenlyfqgadsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfra
hktvlmacsglfysiftdqlkcnlsvinldpeinpegfcilldfmytsrlnlregnimav
matamylqmehvvdtcrkfikase

    Sequence, based on observed residues (ATOM records): (download) 
    >6tojA (A:)
nlyfqgadsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfy
siftdqlkcnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvv
dtcrkfikase