PDB entry 6tnn

View 6tnn on RCSB PDB site
Description: Mini-RNase III (Mini-III) bound to 50S ribosome with precursor 23S rRNA
Class: ribosomal protein
Keywords: Mini-RNase III, Mini-III, complex, ribosome, 50S, RNA maturation, RNA processing, precursor 23S rRNA, pre-23S rRNA, 23S rRNA, L3, Ribosomal protein, RNase III-like fold, RNase
Deposited on 2019-12-09, released 2020-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: EM
Resolution: 3.07 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Mini-ribonuclease 3
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: mrnC, yazC, BSU00950
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31418
      • conflict (22)
    Domains in SCOPe 2.07: d6tnnh_
  • Chain 'I':
    Compound: Mini-ribonuclease 3
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: mrnC, yazC, BSU00950
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31418 (0-End)
      • conflict (22)
    Domains in SCOPe 2.07: d6tnni_
  • Chain 'U':
    Compound: pre-23S rRNA
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
  • Chain 'V':
    Compound: 5s rRNA
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
  • Chain 'W':
    Compound: 50S ribosomal protein L2
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L3
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L4
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L5
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: 50S ribosomal protein L6
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 50s ribosomal protein l10
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: 50S ribosomal protein L13
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: 50S ribosomal protein L14
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: 50S ribosomal protein L15
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 50S ribosomal protein L16
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: 50S ribosomal protein L17
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: 50S ribosomal protein L18
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: 50S ribosomal protein L19
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: 50S ribosomal protein L20
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: 50S ribosomal protein L21
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: 50S ribosomal protein L22
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: 50S ribosomal protein L23
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: 50S ribosomal protein L24
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: 50S ribosomal protein L27
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: 50S ribosomal protein L32
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: 50S ribosomal protein L33 1
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: 50S ribosomal protein L34
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: 50S ribosomal protein L35
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: 50S ribosomal protein L36
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: 50S ribosomal protein L28
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: 50S ribosomal protein L29
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: 50S ribosomal protein L30
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ZN

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6tnnH (H:)
    mlefdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqae
    ilfflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeer
    lsqlvaeaiqfgtsgrktnesat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tnnH (H:)
    efdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqaeil
    fflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeerls
    qlvaeaiqfgts
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6tnnI (I:)
    mlefdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqae
    ilfflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeer
    lsqlvaeaiqfgtsgrktnesat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tnnI (I:)
    mlefdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqae
    ilfflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeer
    lsqlvaeaiqfgts
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.