PDB entry 6tn7

View 6tn7 on RCSB PDB site
Description: crystal structure of the human arc c-lobe
Deposited on 2019-12-06, released 2020-12-16
The last revision was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Activity-regulated cytoskeleton-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ARC, KIAA0278
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6tn7B (B:)
gamgtlsreaiqreldlpqkqgepldqflwrkrdlyqtlyvdadeeeiiqyvvgtlqpkl
krflrhplpktleqliqrgmevqddleqaaepagphl

    Sequence, based on observed residues (ATOM records):
    >6tn7B (B:)
tlsreaiqreldlpqkqgepldqflwrkrdlyqtlyvdadeeeiiqyvvgtlqpklkrfl
rhplpktleqliqrgmevqddleqaae