PDB entry 6tlx

View 6tlx on RCSB PDB site
Description: crystal structure of the unconventional kinetochore protein perkinsela sp. kkt2a central domain
Deposited on 2019-12-03, released 2019-12-25
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase
    Species: Perkinsela sp. CCAP 1560/4 [TaxId:1314962]
    Gene: XU18_4017
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6tlxA (A:)
gssqkfstspsptlddgldrikcpkkhgmkllrafpklndtaggtsdygwgfwcdrchke
vpalikskkriskaqderthapeentffyhchcgydlckacgasiihasntlkenystel
knlaacfstps

    Sequence, based on observed residues (ATOM records):
    >6tlxA (A:)
drikcpkkhgmkllrafpklndtaggtsdygwgfwcdrchkevpalikskkriskaqder
thapeentffyhchcgydlckacgasiihasntlkenystelknlaacfstp