PDB entry 6tlg

View 6tlg on RCSB PDB site
Description: Ligand-free state of human 14-3-3 sigma isoform
Class: signaling protein
Keywords: human protein, 14-3-3, sigma isoform, h14-3-3sigma, signaling protein
Deposited on 2019-12-02, released 2020-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (28-End)
      • expression tag (23-27)
    Domains in SCOPe 2.07: d6tlga1, d6tlga2
  • Heterogens: PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tlgA (A:)
    msyyhhhhhhdydipttenlyfqgamgsmerasliqkaklaeqaeryedmaafmkgavek
    geelsceernllsvayknvvggqraawrvlssieqksneegseekgpevreyrekvetel
    qgvcdtvlglldshlikeagdaesrvfylkmkgdyyrylaevatgddkkriidsarsayq
    eamdiskkempptnpirlglalnfsvfhyeianspeeaislakttfdeamadlhtlseds
    ykdstlimqllrdnltlwtadnageeggeapqepqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tlgA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegekgpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlssykdstlimqllrdnltlwt