PDB entry 6tlf

View 6tlf on RCSB PDB site
Description: human 14-3-3 sigma isoform in complex with IMP
Class: signaling protein
Keywords: human protein, h14-3-3sigma, signaling protein, complex, inosine monophosphate, IMP
Deposited on 2019-12-02, released 2020-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (28-End)
      • expression tag (23-27)
    Domains in SCOPe 2.07: d6tlfa1, d6tlfa2
  • Heterogens: IMP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tlfA (A:)
    msyyhhhhhhdydipttenlyfqgamgsmerasliqkaklaeqaeryedmaafmkgavek
    geelsceernllsvayknvvggqraawrvlssieqksneegseekgpevreyrekvetel
    qgvcdtvlglldshlikeagdaesrvfylkmkgdyyrylaevatgddkkriidsarsayq
    eamdiskkempptnpirlglalnfsvfhyeianspeeaislakttfdeamadlhtlseds
    ykdstlimqllrdnltlwtadnageeggeapqepqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tlfA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksnekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
    lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtkdstlimqllrdnltlwt