PDB entry 6tlc

View 6tlc on RCSB PDB site
Description: Unphosphorylated human STAT3 in complex with MS3-6 monobody
Class: transcription
Keywords: Inhibitor, Complex, STAT3, Monobody, TRANSCRIPTION
Deposited on 2019-12-02, released 2020-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal transducer and activator of transcription 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Stat3, Aprf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tlca1, d6tlca2, d6tlca3
  • Chain 'B':
    Compound: Signal transducer and activator of transcription 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Stat3, Aprf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6tlcb1, d6tlcb2, d6tlcb3
  • Chain 'C':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6TLC (0-94)
    Domains in SCOPe 2.07: d6tlcc_
  • Chain 'D':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6TLC (0-94)
    Domains in SCOPe 2.07: d6tlcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tlcA (A:)
    gsgqanhptaavvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgd
    mqdlngnnqsvtrqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwk
    rrqqiaciggppnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpm
    leerivelfrnlmksafvverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlki
    kvcidkdsgdvaalrgsrkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggra
    ncdaslivteelhlitfetevyhqglkidlethslpvvvisnicqmpnawasilwynmlt
    nnpknvnfftkppigtwdqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqi
    twakfckenmagkgfsfwvwldniidlvkkyilalwnegyimgfiskererailstkppg
    tfllrfsesskeggvtftwvekdisgktqiqsvepytkqqlnnmsfaeiimgykimdatn
    ilvsplvylypdipkeeafgkycrpesqehpeadpgsaapylktkficvtpttcsnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tlcA (A:)
    vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlngnnqsv
    trqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggp
    pnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrn
    lmksafvverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdrkfn
    ilgtntkvmnmeenngslsaefkhltlreqraslivteelhlitfetevyhqglkidlet
    hslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtwdqvaevlswqfsstt
    krglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsfwvwldniidlvkkyi
    lalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgktqiqs
    vepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tlcB (B:)
    gsgqanhptaavvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgd
    mqdlngnnqsvtrqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwk
    rrqqiaciggppnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpm
    leerivelfrnlmksafvverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlki
    kvcidkdsgdvaalrgsrkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggra
    ncdaslivteelhlitfetevyhqglkidlethslpvvvisnicqmpnawasilwynmlt
    nnpknvnfftkppigtwdqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqi
    twakfckenmagkgfsfwvwldniidlvkkyilalwnegyimgfiskererailstkppg
    tfllrfsesskeggvtftwvekdisgktqiqsvepytkqqlnnmsfaeiimgykimdatn
    ilvsplvylypdipkeeafgkycrpesqehpeadpgsaapylktkficvtpttcsnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tlcB (B:)
    vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlnnqsvtr
    qkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggppn
    icldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrnlm
    ksafvverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdrgsrkf
    nilgtntkvmnmeesnngslsaefkhltlreqrcgslivteelhlitfetevyhqglkid
    lethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtwdqvaevlswqfs
    sttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsfwvwldniidlvk
    kyilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgktq
    iqsvepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tlcC (C:)
    gsvssvptklevvaatptslliswdapavtvdfyhitygetggnspvqeftvpgskstat
    isglkpgvdytitvyayvsypeyyfpspisinyrt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tlcD (D:)
    gsvssvptklevvaatptslliswdapavtvdfyhitygetggnspvqeftvpgskstat
    isglkpgvdytitvyayvsypeyyfpspisinyrt