PDB entry 6tl0

View 6tl0 on RCSB PDB site
Description: Solution structure and 1H, 13C and 15N chemical shift assignments for the complex of VPS29 with VARP 687-747
Class: intracellular vesicle trafficking
Keywords: VARP, retromer, NMR complex structure, Zinc finger, endosome, INTRACELLULAR VESICLE TRAFFICKING
Deposited on 2019-11-29, released 2020-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: Mus musculus [TaxId:10090]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ88 (10-191)
      • expression tag (0-9)
    Domains in SCOPe 2.08: d6tl0a1, d6tl0a2
  • Chain 'B':
    Compound: ankyrin repeat domain-containing protein 27
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKRD27, PP12899
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96NW4 (5-59)
      • expression tag (0-4)
      • expression tag (60)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tl0A (A:)
    gspefgtrdrmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylk
    tlagdvhivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdi
    lisghthkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligd
    dvkverieykks
    

  • Chain 'B':
    No sequence available.