PDB entry 6tkt

View 6tkt on RCSB PDB site
Description: structure of the bacterial toxin phenomycin
Deposited on 2019-11-28, released 2020-01-22
The last revision was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-phenomycin
    Species: Streptomyces roseoverticillatus [TaxId:66429]
    Gene: phM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53805 (4-92)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tktA (A:)
gamanpktikaaaynqarstladagsrtaakshpihgktdvpvsygtsllaaardefrqa
dkklpakdkksdmsiahynavhsaaktmgidtw