PDB entry 6tk0

View 6tk0 on RCSB PDB site
Description: cytochrome c from thioalkalivibrio paradoxus
Deposited on 2019-11-27, released 2020-12-16
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Cytochrome c, mono-and diheme variants family
    Species: Thioalkalivibrio nitratireducens DSM 14787 [TaxId:1255043]
    Gene: TVNIR_2751
    Database cross-references and differences (RAF-indexed):
    • Uniprot L0DXU7 (21-135)
      • initiating methionine (0)
      • expression tag (1-20)
      • conflict (24)
      • conflict (31)
      • conflict (87)
      • conflict (132)
      • conflict (134)
      • expression tag (136-152)
  • Heterogens: HEC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >6tk0X (X:)
mdiginsdphpphhhdhhghgsgwevpeaeihrenpippdarsldqggvlyaehcvrchg
etlrgdgpdahdldppvadlvehaphhsdgdlayrvrigrgpmpgfgdalderdiwdlvn
fmrdraqgaalagtnghspdhaagdhhhgdhhh