PDB entry 6tj5

View 6tj5 on RCSB PDB site
Description: T. gondii myosin A trimeric complex with ELC1
Class: motor protein
Keywords: motility, glideosome, light chain, myosin, MOTOR PROTEIN
Deposited on 2019-11-25, released 2020-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin, putative
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: BN1205_016670
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin light chain TgMLC1
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95UJ7 (Start-144)
      • expression tag (145-147)
    Domains in SCOPe 2.07: d6tj5b1, d6tj5b2
  • Chain 'C':
    Compound: Myosin-A
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00934 (4-45)
      • expression tag (2-3)
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6tj5B (B:)
adedmqealeemveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksg
dnldyasfqkfvgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygeplttee
fnalaaeyftsdqidyrqfckamleaenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >6tj5B (B:)
mveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyasfqkf
vgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaaeyfts
dqidyrqfckamleaen

  • Chain 'C':
    No sequence available.