PDB entry 6tj3

View 6tj3 on RCSB PDB site
Description: p. falciparum essential light chain, n-terminal domain
Deposited on 2019-11-25, released 2020-10-28
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PfELC
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF3D7_1017500
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tj3A (A:)
masdmeekfreafilfsscsdhiemykffelmnsfgiiltndekaalpndinmdywlnfa
kkhynyeqpfkhin